DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT1G14820

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_973831.1 Gene:AT1G14820 / 838047 AraportID:AT1G14820 Length:252 Species:Arabidopsis thaliana


Alignment Length:255 Identity:48/255 - (18%)
Similarity:94/255 - (36%) Gaps:52/255 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LQRFLEMYDLDMETSFNSL--WETCILRQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLV 110
            |.|||....:|...:....  |:............|.|||: |:.|:...|.:......|.||::
plant    31 LMRFLVARSMDPVKAAKMFVDWQKWRASMVPPTGFIPESEV-QDELEFRKVCLQGPTKSGHPLVL 94

  Fly   111 FRVKMHSKSKNLDELIRIVVYWVERT------QREQHLTQLTIFFDMSGTSLASMDLEFVKRIVE 169
            .....|..||:.....:.|||.:::|      .:|....:|....|::..:..::|...:....:
plant    95 VITSKHFASKDPANFKKFVVYALDKTIASGNNGKEVGGEKLVAVIDLANITYKNLDARGLITGFQ 159

  Fly   170 TFKQFYPNSLN--YILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINK---DNCLA 229
            ..:.:||..|.  |||                 .:|...|.:.|.:.:     ::.|   :..:.
plant   160 FLQSYYPERLAKCYIL-----------------HMPGFFVTVWKFVCR-----FLEKATQEKIVI 202

  Fly   230 IWGGEDNYEFSFVPEAKKVISKPVAANAGDDDQFADKKVTFV------DSAPMVLKETNI 283
            :..||:..:|          .:.:.|:|..::.....|:|.:      .:||:.|...|:
plant   203 VTDGEEQRKF----------EEEIGADALPEEYGGRAKLTAIQDVLLPQAAPVTLTNNNV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 25/150 (17%)
Motile_Sperm 293..396 CDD:279029
AT1G14820NP_973831.1 CRAL_TRIO_N 6..51 CDD:215024 5/19 (26%)
SEC14 80..227 CDD:238099 30/178 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.