DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and AT5G63060

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:227 Identity:46/227 - (20%)
Similarity:104/227 - (45%) Gaps:37/227 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCILRQSTGAN 79
            |:::|. .|..:|.|...:...|.|.|    ||   ||:.....::.:...|.:....|     :
plant    50 EVKERL-AKDCTSLPLGKYGRDDEDMI----LW---FLKDRRFSVDEAIGKLTKAIKWR-----H 101

  Fly    80 DIDESELNQEYLK----EGSVFVHN-TDVDGKPLLVFRVKMHSKSKNLDELI------RIVVYWV 133
            :....||:::.:|    .|..:||. .||.|:|:::.     :.:|::..|:      ::.|:.:
plant   102 EFKVDELSEDSIKAATDTGKAYVHGFLDVKGRPVVIV-----APAKHIPGLLDPIEDEKLCVFLL 161

  Fly   134 ERTQRE----QHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQFYPNSLNYILVYELGWVLNAA 194
            |:...:    ||  ::...||:.|....:.||:|:..:.:.|..:||:.|:.:|..:..::....
plant   162 EKALSKLPAGQH--KILGIFDLRGFGSQNADLKFLTFLFDVFYYYYPSRLDEVLFVDAPFIFQPI 224

  Fly   195 FKVIKAVLPPKAVEILKMISKKDI-NQYINKD 225
            ::..|.::...| .::|..|.:.: .:|..::
plant   225 WQFTKPLVKQYA-SLVKFCSAETVRKEYFTEE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 29/144 (20%)
Motile_Sperm 293..396 CDD:279029
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 29/146 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.