DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and SEC14

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_195629.2 Gene:SEC14 / 830073 AraportID:AT4G39180 Length:554 Species:Arabidopsis thaliana


Alignment Length:334 Identity:67/334 - (20%)
Similarity:128/334 - (38%) Gaps:94/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 NDHLWLQRFLEMYDLDMETSFNSLWETCI-LRQSTGAN----DIDESELNQ--EYLKEGSVFVHN 100
            :||..:.|||.....|:|.: ..:|...: .|:..||:    |.|..|:.:  :|..:|   .|.
plant    92 DDHHMMLRFLRARKFDLEKA-KQMWSDMLNWRKEYGADTIMEDFDFKEIEEVVKYYPQG---YHG 152

  Fly   101 TDVDGKPLLVFRVKMHSKSK-----NLDELIRIVVYWVERT----------QREQHLTQLTIFFD 150
            .|.:|:|:.:.|:.....:|     .:|..::..|...|:|          ..::|:.|.|...|
plant   153 VDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILD 217

  Fly   151 MSGTSLASMDLEFVKRIVETFKQF----YPNSLNYILVYELGWVLNAAFKVIKAVLPPKA----- 206
            :.|..|::.: :..|.::::.::.    ||.:||.:.:...|......:..:|:.|.||.     
plant   218 VQGVGLSNFN-KAAKDLLQSIQKIDNDNYPETLNRMFIINAGCGFRLLWNTVKSFLDPKTTAKIH 281

  Fly   207 -------VEILKMISKKDINQYI-------NKDNCL--------------------------AIW 231
                   .::|::|...::.:::       :|..|:                          ::.
plant   282 VLGNKYQTKLLEIIDANELPEFLGGKCTCADKGGCMRSDKGPWNDPEIFKLVQNGEGRCLRRSLS 346

  Fly   232 GGEDNYEFSFVPEAKKVIS-----KPVAANAGDDDQFADKKVTFVDSAPMVLKETNINKMHTPSE 291
            |.|:...|.:..|.||...     |..||..  :.:|.|   |.||:|......|.:||...   
plant   347 GIEEKTIFEYNNETKKKCEPEETHKQSAAEM--EKKFID---TNVDAAAAADWPTKLNKAEK--- 403

  Fly   292 GMLHINPKD 300
                 ||.|
plant   404 -----NPTD 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 32/203 (16%)
Motile_Sperm 293..396 CDD:279029 3/8 (38%)
SEC14NP_195629.2 CRAL_TRIO_N 72..115 CDD:215024 7/23 (30%)
SEC14 138..308 CDD:214706 31/173 (18%)
Prefoldin 491..>529 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.