DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and VAP27-1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_567101.1 Gene:VAP27-1 / 825231 AraportID:AT3G60600 Length:256 Species:Arabidopsis thaliana


Alignment Length:92 Identity:25/92 - (27%)
Similarity:50/92 - (54%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 MLHINPKD--FVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIW 355
            :|.:.|.|  |.....|....::.:.:...:.|.:|::||:|:|:.|||..|::.|.....:.:.
plant    22 LLTVEPLDLQFPFELKKQISCSLYLTNKTDNNVAFKVKTTNPKKYCVRPNTGVVLPRSTCEVLVT 86

  Fly   356 LKSEHKLSDD--SKDKFLVMAMVA-PG 379
            ::::.:...|  .|||||:..::| ||
plant    87 MQAQKEAPSDMQCKDKFLLQGVIASPG 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 25/92 (27%)
VAP27-1NP_567101.1 Motile_Sperm 22..129 CDD:334183 25/92 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.