DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and PVA12

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_182039.1 Gene:PVA12 / 819122 AraportID:AT2G45140 Length:239 Species:Arabidopsis thaliana


Alignment Length:255 Identity:59/255 - (23%)
Similarity:90/255 - (35%) Gaps:95/255 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 SEGMLHINPKD--FVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATI 352
            |..:|.|:|.|  |.....|....::.:.:...:.|.:|::||:|:|:.|||..|::.|...:.:
plant     2 SNELLTIDPVDLQFPFELKKQISCSLYLGNKTDNYVAFKVKTTNPKKYCVRPNTGVVHPRSSSEV 66

  Fly   353 NIWLKSEHKLSDD--SKDKFLVMAMVA-PGGECGGADVTELWRSK-------------------- 394
            .:.::::.:...|  .|||||:..:|| ||..  ..|||....||                    
plant    67 LVTMQAQKEAPADLQCKDKFLLQCVVASPGAT--PKDVTHEMFSKEAGHRVEETKLRVVYVAPPR 129

  Fly   395 --SPT-----------------------------SAD--------VEQHRLVCRFDENKSKA--- 417
              ||.                             |||        .|...||.:..|.|:.|   
plant   130 PPSPVREGSEEGSSPRASVSDNGNASDFTAAPRFSADRVDAQDNSSEARALVTKLTEEKNSAVQL 194

  Fly   418 ------QLDCASKSSKASVDCSKKSGAGVDPATAMERQLAFTQNLQYVTLALLFLLFAGF 471
                  :||...:.||.|     ||| |:.              ..||.|..|..|..|:
plant   195 NNRLQQELDQLRRESKRS-----KSG-GIP--------------FMYVLLVGLIGLILGY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 32/129 (25%)
PVA12NP_182039.1 Motile_Sperm 5..112 CDD:459882 32/108 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.