DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Ttpal

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_083788.2 Gene:Ttpal / 76080 MGIID:1923330 Length:343 Species:Mus musculus


Alignment Length:268 Identity:58/268 - (21%)
Similarity:96/268 - (35%) Gaps:58/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSL--------- 66
            :.::.|||...::|       |:..|.:     |..:|.|||.....|.:.:...|         
Mouse    57 RDVQALRDMVRKEY-------PYLSTSL-----DDAFLLRFLRARKFDYDRALQLLVNYHGCRRS 109

  Fly    67 WETCI--LRQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSK-NLDELIRI 128
            |....  ||.| ...|:    ||..:|   :|..| ||..|..:|..|......|. .:.|.||.
Mouse   110 WPEVFSNLRPS-ALKDV----LNSGFL---TVLPH-TDPRGCHVLCIRPDRWIPSNYPITENIRA 165

  Fly   129 VVYWVER--TQREQHLTQLTIFFDMSGTSL--ASMDLEFV-KRIVETFKQFYPNSLNYILVYELG 188
            |...:|:  ...|..:..:.|..|..|.||  ||....|: |:::...:..:|..:..:.:....
Mouse   166 VYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHIVNEP 230

  Fly   189 WVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINKDNCLAIWGGEDNYEFSFVPEAKKVISKPV 253
            .:....|.:||..|..|..                  |...:.|.:.|...:.:|  :.::.|..
Mouse   231 RIFKGIFAIIKPFLKEKIA------------------NRFFLHGSDLNSLHTNLP--RNILPKEY 275

  Fly   254 AANAGDDD 261
            ...||:.|
Mouse   276 GGTAGELD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 31/145 (21%)
Motile_Sperm 293..396 CDD:279029
TtpalNP_083788.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
CRAL_TRIO_N 57..103 CDD:215024 13/57 (23%)
SEC14 122..278 CDD:238099 38/183 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.