DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:467 Identity:88/467 - (18%)
Similarity:169/467 - (36%) Gaps:148/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSPPAA--PFHPTDIDRIRNDHL--------------------WLQ--------------RFLEM 54
            |||..|  |...|..|::..|::                    |||              |||..
Mouse   222 SSPGTASEPVVGTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRA 286

  Fly    55 YDLDMETSFNSLWETCILRQSTGANDIDES----ELNQEYLKEGSVFVHNTDVDGKPLLVFRV-K 114
            .|.:::.:...:.::...|:....:.|.::    ::..:|...|   .|:.|.||:||.|.|: :
Mouse   287 RDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLDYYAGG---WHHHDKDGRPLYVLRLGQ 348

  Fly   115 MHSKS--KNLDE--LIRIVVYWVERTQRE---------QHLTQLTIFFDMSGTSLASMDLEFVK- 165
            |.:|.  :.|.|  |:|.|:...|...|.         :.::..|...|:.|.::..:....|| 
Mouse   349 MDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKA 413

  Fly   166 --RIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINKDNCL 228
              ||:|..:..||.:|..:|             :::|   |:...:|..:    ::.:|      
Mouse   414 LLRIIEVVEANYPETLGRLL-------------ILRA---PRVFPVLWTL----VSPFI------ 452

  Fly   229 AIWGGEDNYEFSFVPEAKKVISKPVAANAGDDDQ-------FADKKV--TFVDSAPMVLKETNIN 284
                 :||....|:            ..||:|.|       :.||::  .|:....|        
Mouse   453 -----DDNTRRKFL------------IYAGNDYQGPGGLLDYIDKEIIPDFLSGECM-------- 492

  Fly   285 KMHTPSEGMLHINPKDFVNF--NSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPN 347
             ...|..|::   ||.....  ..:|.:..:..::|..||..:|   .:|.:..::    |:..:
Mouse   493 -CDVPEGGLV---PKSLYRTAEELENEDLKLWTETIYQSASVFK---GAPHEILIQ----IVDAS 546

  Fly   348 QEAT-----------INIWLKSEHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADV 401
            ...|           .||: .|:.......||.....::.:|||. ....:.::|:.....|  :
Mouse   547 SVITWDFDVCKGDIVFNIY-HSKRSPQPPKKDSLGAHSITSPGGN-NVQLIDKVWQLGRDYS--M 607

  Fly   402 EQHRLVCRFDEN 413
            .:..|:|:..|:
Mouse   608 VESPLICKEGES 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/156 (22%)
Motile_Sperm 293..396 CDD:279029 19/115 (17%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 67/345 (19%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 7/44 (16%)
CRAL_TRIO 326..490 CDD:279044 45/209 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.