DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Mospd3

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:XP_006504675.1 Gene:Mospd3 / 68929 MGIID:1916179 Length:265 Species:Mus musculus


Alignment Length:116 Identity:26/116 - (22%)
Similarity:54/116 - (46%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 PSEG---MLHINPKDFVNFNS---KNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPN 347
            ||.|   .:.:.|.|.| |.:   ......:|:.:...:|:.:::..|:|.|:.|....|.::| 
Mouse    26 PSSGPVVPVLVFPPDLV-FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKP- 88

  Fly   348 QEATINIWLKSEHKLSD--DSKDKFLVMAMVAPGGE---CGGADVTELWRS 393
             ::.|:|.::....:..  |.:|:|.: .:...|.|   .|..|:|.:.|:
Mouse    89 -QSCIDIVIRHVAPVPSHYDVQDRFRI-ELSEEGTEGRVVGRKDITSVLRA 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 23/109 (21%)
Mospd3XP_006504675.1 Motile_Sperm 41..133 CDD:459882 19/95 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.