Sequence 1: | NP_001261457.1 | Gene: | CG33523 / 38668 | FlyBaseID: | FBgn0053523 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001035186.1 | Gene: | MOSPD3 / 64598 | HGNCID: | 25078 | Length: | 235 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 78/199 - (39%) | Gaps: | 37/199 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 313 MTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWLKSEHKLSD--DSKDKFLVMAM 375
Fly 376 V--APGGECGGADVTELWRSKS-PTSADVEQHRLVCRFDENKSKAQLDCASKSSKASVDCSKKSG 437
Fly 438 AGVDPATAMERQLAFTQNLQYVTLALLFLL--FAGFGFLMYQQLGQHAATCPKATAYSCAKR--K 498
Fly 499 XYLL 502 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33523 | NP_001261457.1 | CRAL_TRIO | 94..234 | CDD:279044 | |
Motile_Sperm | 293..396 | CDD:279029 | 19/87 (22%) | ||
MOSPD3 | NP_001035186.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
Motile_Sperm | 41..>118 | CDD:306983 | 13/64 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 143..171 | 9/36 (25%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5066 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |