DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_072130.1 Gene:Sec14l3 / 64543 RGDID:620812 Length:400 Species:Rattus norvegicus


Alignment Length:265 Identity:59/265 - (22%)
Similarity:111/265 - (41%) Gaps:54/265 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKVKETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNS 65
            |..:|.:.:|:|.|.|. :|........||.| :|        |..:|.|:|...:.|::.|...
  Rat     1 MSGRVGDLSPKQAETLA-KFRENVQDVLPALP-NP--------DDYFLLRWLRARNFDLQKSEAM 55

  Fly    66 LWETCILRQSTGANDIDE------SELNQEYLKEGSVFVHNTDVDGKPL------------LVFR 112
            |.:....|::.   |||.      .|:.|:|:..|   :...|.||.||            |:|.
  Rat    56 LRKYMEFRKTM---DIDHILDWQPPEVIQKYMPGG---LCGYDRDGCPLWYDIIGPLDPKGLLFS 114

  Fly   113 VK----MHSKSKNLDELIRIVVYWVERTQREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQ 173
            |.    :.:|.::.:.::.......||..|:  :..:.:.||..|..|.    .|.|.:||.:::
  Rat   115 VTKQDLLKTKMRDCERILHECDLQTERLGRK--IETIVMIFDCEGLGLK----HFWKPLVEVYQE 173

  Fly   174 F-------YPNSLNYILVYELGWVLNAAFKVIKAVLPP---KAVEILKMISKKDINQYINKDNCL 228
            |       ||.:|.::|:.:...:....:.::|..|..   :.:.:|....|:.:.:.|:.:...
  Rat   174 FFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGNSWKEGLLKLISPEELP 238

  Fly   229 AIWGG 233
            |.:||
  Rat   239 AHFGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/166 (20%)
Motile_Sperm 293..396 CDD:279029
Sec14l3NP_072130.1 CRAL_TRIO_N 13..59 CDD:215024 14/55 (25%)
SEC14 76..245 CDD:214706 37/177 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.