DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Vapb

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_062780.2 Gene:Vapb / 56491 MGIID:1928744 Length:243 Species:Mus musculus


Alignment Length:163 Identity:39/163 - (23%)
Similarity:73/163 - (44%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 EGMLHINPKDFVNFNSKNAEATMTIKSIATSA---VTYKIQTTSPEKFRVRPRCGIIQPNQEATI 352
            |.:|.:.|:..:.|.....:...|...:....   |.:|::||:|.::.|||..|:|.......:
Mouse     5 EQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGVIDAGASLNV 69

  Fly   353 NIWLKS-EHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFD---EN 413
            ::.|:. ::..::.||.||:|.:|.||...   :|:..:|:...|  .|:...:|.|.|:   ||
Mouse    70 SVMLQPFDYDPNEKSKHKFMVQSMFAPPDT---SDMEAVWKEAKP--EDLMDSKLRCVFELPAEN 129

  Fly   414 ---------------KSKAQLDCASKSSKASVD 431
                           .||.:...|:||..:.:|
Mouse   130 AKPHDVEINKIIPTSASKTEAPAAAKSLTSPLD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 25/106 (24%)
VapbNP_062780.2 Motile_Sperm 8..111 CDD:459882 25/105 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.