DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Sec14l4

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001102560.1 Gene:Sec14l4 / 498399 RGDID:1565810 Length:412 Species:Rattus norvegicus


Alignment Length:263 Identity:58/263 - (22%)
Similarity:105/263 - (39%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKVKETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNS 65
            |..:|.:.:|||.|.| .||........|..|         :.|..:|.|:|...:.|::.|.:.
  Rat     1 MSGQVGDLSPQQQEAL-TRFREILQDVLPTLP---------KADDFFLLRWLRARNFDLKKSEDM 55

  Fly    66 LWETCILRQSTGANDIDE------SELNQEYLKEGSVFVHNTDVDGKPLLVFRV-----KMHSKS 119
            |.:....|..   .|:|.      .|:.:.|...|   :...|.:|.|:....:     |....|
  Rat    56 LRKHVEFRNQ---QDLDHILTWQPPEVIRLYDSGG---LCGYDYEGCPVWFDLIGTLDPKGLFMS 114

  Fly   120 KNLDELIRIVVYWVERTQRE---------QHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQF- 174
            .:..:|||..:...|....|         :.:.::.:.|||.|.||..:    .|..||.::|| 
  Rat   115 ASKQDLIRKRIKVCEMLLHECELQSQKLGRKVERMVMVFDMEGLSLRHL----WKPAVEVYQQFF 175

  Fly   175 ------YPNSLNYILVYELGWVLNAAFKVIKAVL---PPKAVEILKMISKKDINQYINKDNCLAI 230
                  ||.::..::|.....:...||.::|:.:   ..|.:.||....|:::.::::.|.....
  Rat   176 AILEANYPETVKNLIVIRAPKLFPVAFNLVKSFIGEVTQKKIVILGGNWKQELLKFMSPDQLPVE 240

  Fly   231 WGG 233
            :||
  Rat   241 FGG 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 35/164 (21%)
Motile_Sperm 293..396 CDD:279029
Sec14l4NP_001102560.1 CRAL_TRIO_N 13..59 CDD:215024 13/55 (24%)
SEC14 76..244 CDD:214706 37/175 (21%)
GOLD_2 284..379 CDD:404736
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.