DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and sec14l5

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:XP_031749906.1 Gene:sec14l5 / 493292 XenbaseID:XB-GENE-953433 Length:793 Species:Xenopus tropicalis


Alignment Length:286 Identity:62/286 - (21%)
Similarity:109/286 - (38%) Gaps:69/286 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SSPPAA--PFHPTDIDRIRNDHL--------------------WLQ--------------RFLEM 54
            |||.||  ....|..|::..|::                    |||              |||..
 Frog   222 SSPTAATHELSSTPDDKLDADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRA 286

  Fly    55 YDLDMETSFNSLWETCILRQSTGANDI----DESELNQEYLKEGSVFVHNTDVDGKPLLVFRV-K 114
            .|.:::.:...|.::...|:....:.:    |..::..:|...|   .|:.|.||:||.|.|: :
 Frog   287 RDFNIDKAREILCQSLTWRKQHHVDYLLSTWDPPQVLHDYYAGG---WHHHDRDGRPLYVLRLGQ 348

  Fly   115 MHSKS--KNLDE--LIRIVVYWVERTQRE---------QHLTQLTIFFDMSGTSLASMDLEFVK- 165
            |.:|.  :.|.|  |:|.|:...|...|.         :.::..|...|:.|.::..:....|| 
 Frog   349 MDTKGLVRALGEESLLRHVLSINEEGLRRCEENTNIFGRPISSWTCLVDLEGLNMRHLWRPGVKA 413

  Fly   166 --RIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMISKKD------INQYI 222
              ||:|..:..||.:|..:|:.....|....:.::...:.....:...:.:..|      :..||
 Frog   414 LLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQGPGGLIDYI 478

  Fly   223 NKDNCLAIWGGEDNYEFS---FVPEA 245
            :|:......|||...|.|   .||:|
 Frog   479 DKEVIPDFLGGECMCEVSEGGMVPKA 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 36/162 (22%)
Motile_Sperm 293..396 CDD:279029
sec14l5XP_031749906.1 PRELI 17..173 CDD:398400
CRAL_TRIO_N 256..301 CDD:215024 8/44 (18%)
CRAL_TRIO 326..490 CDD:395525 37/166 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.