DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and vapal

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001002546.1 Gene:vapal / 436819 ZFINID:ZDB-GENE-040718-281 Length:246 Species:Danio rerio


Alignment Length:179 Identity:51/179 - (28%)
Similarity:88/179 - (49%) Gaps:17/179 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 EGMLHINPKDFVNFNSKNAE---ATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATI 352
            |.:|.::|.:.:.|.....:   |.:.:|:.:...|.:|::||:|.::.|||..|||.|....||
Zfish     5 EQILVLDPPNDLKFKGPFTDVVTANLKLKNPSERKVCFKVKTTAPRRYCVRPNSGIIDPGATLTI 69

  Fly   353 NIWLKS-EHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFD---EN 413
            ::.|:. ::..::.||.||:|..:.||...   :|...:|:...|.  ::...:|.|.|:   ||
Zfish    70 SVMLQPFDYDPNEKSKHKFMVQTIFAPPAV---SDTEAMWKDAKPD--ELMDSKLRCVFELPSEN 129

  Fly   414 KSKAQLDCASK-----SSKASVDCSKKSGAGVDPATAMERQLAFTQNLQ 457
            ....::|.|.|     ||||....|.|..:|....:.|.|.|...:.||
Zfish   130 DKVNEVDSACKVPVLNSSKADGLLSVKPLSGAHDDSEMRRILEDRKRLQ 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 29/106 (27%)
vapalNP_001002546.1 Motile_Sperm 7..111 CDD:279029 29/106 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.