DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and ZK688.12

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001370359.1 Gene:ZK688.12 / 4363060 WormBaseID:WBGene00044763 Length:173 Species:Caenorhabditis elegans


Alignment Length:47 Identity:18/47 - (38%)
Similarity:26/47 - (55%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   310 EATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWL 356
            ||.:.||:...:..||||:.|:.:.|.:|...|.|.|  |.:|.|.|
 Worm    37 EARLVIKNPTKNRYTYKIKVTNNDMFDIRTPKGFIDP--ETSIEIEL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 18/47 (38%)
ZK688.12NP_001370359.1 Motile_Sperm 16..>103 CDD:459882 18/47 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.