DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CG6527

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001287021.1 Gene:CG6527 / 39197 FlyBaseID:FBgn0036085 Length:166 Species:Drosophila melanogaster


Alignment Length:163 Identity:47/163 - (28%)
Similarity:73/163 - (44%) Gaps:19/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 LHINPKDFVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWLKS 358
            |.|:|...:.|...|.:..:|||::....||||:|.|...||.::||.|::.||:.:.:.|.:..
  Fly     8 LEISPNSTLTFTKTNNKHEITIKNVGEKTVTYKVQCTVHGKFNIKPRWGVLSPNEHSHVLITMCK 72

  Fly   359 EHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFDENKSKAQLDCAS 423
            :.:||...:||.:|:.||:|............||........:|:|:|.|.        |:|.|.
  Fly    73 DVELSRKGRDKIVVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCH--------QMDGAG 129

  Fly   424 KSSKASVDCSKKSGAGVDPATAMERQLAFTQNL 456
            :.          .|.|.| ..|....|.|.|.|
  Fly   130 EG----------HGDGGD-KDAEPEDLRFRQGL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 32/101 (32%)
CG6527NP_001287021.1 Motile_Sperm 8..110 CDD:279029 32/101 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I11583
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.