DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CG33965

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001033983.1 Gene:CG33965 / 3885668 FlyBaseID:FBgn0053965 Length:317 Species:Drosophila melanogaster


Alignment Length:97 Identity:24/97 - (24%)
Similarity:43/97 - (44%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 LPP----KAVEILKMISKK---DI---NQYINKD----NCLAIWGGEDNYEFSF-------VPEA 245
            |||    .|:|.|..:..:   ||   .:::.|.    .||     ||.:..||       :.:|
  Fly    12 LPPGLQKVAIEELNEVPSRVESDIAALKEWLQKQPHLCACL-----EDQFLLSFLRGSKFSLEKA 71

  Fly   246 KKVISKPVAANAGDDDQFADKKVTFVDSAPMV 277
            |:.|.:..:..|...:.|.|:::  ||:|.::
  Fly    72 KQKIDRFYSLQAVIPEVFNDQRL--VDNAQVL 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 11/45 (24%)
Motile_Sperm 293..396 CDD:279029
CG33965NP_001033983.1 CRAL_TRIO_N 32..77 CDD:215024 12/49 (24%)
SEC14 101..256 CDD:238099 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.