DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:286 Identity:63/286 - (22%)
Similarity:114/286 - (39%) Gaps:74/286 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKVKETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNS 65
            |..:|.:.:|:|.|.|. :|........||.| :|        |..:|.|:|...:.|::.|...
Mouse     1 MSGRVGDLSPKQAETLA-KFRENVQDVLPALP-NP--------DDYFLLRWLRARNFDLQKSEAM 55

  Fly    66 LWETCILRQSTGANDIDE------SELNQEYLKEGSVFVHNTDVDGKPL------------LVFR 112
            |.:....|::.   |||.      .|:.|:|:..|   :...|.||.|:            |:|.
Mouse    56 LRKYMEFRKTM---DIDHILDWQPPEVIQKYMPGG---LCGYDRDGCPVWYDIIGPLDPKGLLFS 114

  Fly   113 VK----MHSKSKNLDELIRIVVYWVERTQREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQ 173
            |.    :.:|.::.:.::.......||..|:  :..:.:.||..|..|.    .|.|.:||.:::
Mouse   115 VTKQDLLKTKMRDCERILHECDLQTERLGRK--IETIVMIFDCEGLGLK----HFWKPLVEVYQE 173

  Fly   174 F-------YPNSLNYILVYELGWVLNAAFKVIKAVLPP----KAV---------EILKMISKKDI 218
            |       ||.:|.::|:.:...:....:.::|..|..    |.|         .:||:||.:::
Mouse   174 FFGLLEENYPETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEEL 238

  Fly   219 NQYI--------NKDNCLA--IWGGE 234
            ..:.        ....||.  .:|||
Mouse   239 PAHFGGTLTDPDGNPKCLTKINYGGE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 36/185 (19%)
Motile_Sperm 293..396 CDD:279029
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 14/55 (25%)
SEC14 76..246 CDD:214706 36/178 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.