DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and C10H11.7

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_491434.1 Gene:C10H11.7 / 3565564 WormBaseID:WBGene00015696 Length:177 Species:Caenorhabditis elegans


Alignment Length:119 Identity:20/119 - (16%)
Similarity:46/119 - (38%) Gaps:22/119 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 KETNINKMHTPSEGMLHINPKDFVNFNSKNAEATM--------------TIKSIATSAVTYKIQT 329
            ||.:::: .|...|.: :|.||...|.......|:              |:.:..:....:|:::
 Worm    16 KEDSVSE-RTTRNGKI-LNAKDEPEFGMNITPTTLFFKYPIGGIGYSFFTVTNTTSEKQAFKVKS 78

  Fly   330 TSPEKFRVRPRCGIIQPNQEATINIWL------KSEHKLSDDSKDKFLVMAMVA 377
            :....||.:|..|.|:..::..:.:..      |...:...|:|:...:..:.|
 Worm    79 SDNTWFRSKPSVGFIKSGEKVHVRVTFNSPDAGKERPERGSDNKNHVAIFHVAA 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 16/105 (15%)
C10H11.7NP_491434.1 Motile_Sperm 41..149 CDD:459882 12/92 (13%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.