DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and F52F12.8

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001021485.1 Gene:F52F12.8 / 3565542 WormBaseID:WBGene00009941 Length:123 Species:Caenorhabditis elegans


Alignment Length:93 Identity:28/93 - (30%)
Similarity:42/93 - (45%) Gaps:5/93 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 PKDFVNFNSKNAEATMTIKSIATSA---VTYKIQTTSPEKFRVRPRCGIIQPNQEATIN-IWLKS 358
            |.|.:.|.:...|...|...|...:   ..:|::.|..:.||::|..||:..||..||. |:...
 Worm    12 PADKIKFRADPKEEQKTFLKITNKSEMKQAFKVKCTRNDLFRIKPATGILDYNQSLTIALIYRGG 76

  Fly   359 EHKLSDDSKDKFLVMAMVAPGG-ECGGA 385
            :..:..|.|..|.|..:.||.| .|.||
 Worm    77 QDNVPSDEKHHFGVYHIPAPEGCTCEGA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 28/93 (30%)
F52F12.8NP_001021485.1 Motile_Sperm 8..100 CDD:459882 25/87 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.