DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CG10237

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:283 Identity:65/283 - (22%)
Similarity:108/283 - (38%) Gaps:53/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETTPQ----QIEELRDRFNRKYASSPPAAPFHPTDIDRI--RNDHLWLQRFLE--MYDLDMETSF 63
            |.|.|    .|:|||:...|:..:|...|.....:.|.:  :.:..||.|:|.  .|..:.....
  Fly    47 EPTAQGKEVAIKELRETPERQKEASKELARLLEAETDLLYPKGNEEWLIRYLRPCKYYPESARDL 111

  Fly    64 NSLWETCILRQSTGANDIDESELNQEYLKEGSVFVH-------NTDVDGKPLLVFRVKMHSKSK- 120
            ...:....::.:....|:..|       .|.::|.|       |.|..|:.:||..:....|.| 
  Fly   112 IKRYYAFKVKHADVYTDLKPS-------NEANIFKHNILTVFPNRDQLGRRILVLELGKRWKHKQ 169

  Fly   121 -NLDELIRIVVYWVERTQREQHLTQL---TIFFDMSGTSLA---SMDLEFVKRIVETFKQFYPNS 178
             .|||:.:..|.::|....|.. ||:   .:.|||.|.||.   .....|.||||:..:...|..
  Fly   170 VTLDEVFKGAVLFLEAAMLEPE-TQICGAVVIFDMDGLSLQQTWQFTPPFAKRIVDWLQDSVPLR 233

  Fly   179 LNYILVYELGWVLNAAFKVIKAVLPPKAVE--ILKMISKKDINQYINKDNCL-AIWGGEDNYEFS 240
            :..|.:.....:....|.:.|..|..|...  |.....::.:::|:: ..|| |.:||       
  Fly   234 IKAIHIVNQPKIFQVVFALFKPFLKEKLRSRIIFHGTDRESLHKYMS-PKCLPAAYGG------- 290

  Fly   241 FVPEAKKVISKPVAANAGDDDQF 263
             ..||.::          |.||:
  Fly   291 -FREASRI----------DSDQW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 40/157 (25%)
Motile_Sperm 293..396 CDD:279029
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 8/46 (17%)
SEC14 137..290 CDD:238099 39/154 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.