DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Ku80

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:393 Identity:76/393 - (19%)
Similarity:132/393 - (33%) Gaps:119/393 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 IRIVVYWVERTQ---RE-QHL---TQLTIFFD--MSGTSLASMDLEFVKRIVETFKQFYPNSLNY 181
            :::|..|.|:.:   || :|.   |::|...:  ::|..|....:.:.:.::|. |:.:|..|::
  Fly   250 VKLVKVWAEKDEIVIRETRHYIKGTEITPLPENLITGYMLGGTPVPYDEAVLEP-KEPHPPGLHF 313

  Fly   182 ILVYELGWVLNAAFKVIKAVLPPKAV---EILKMISKKDINQ------------YINKDNCLAIW 231
                         |..||....|...   |.|.::..:..||            .::.|..:..|
  Fly   314 -------------FGFIKRNAVPDEYFCGESLYLLVHQKHNQSAAVKLDALVRALVSSDRAILCW 365

  Fly   232 GGEDNYEFSFVPEAKKVISKPVAANAGDDDQFADKKVTFVDSAPMVLKETNINKMHTPSEGMLHI 296
               ..|...| ...:.|:..|..|    ||         ...|.:.:.|.:....|       |.
  Fly   366 ---KIYSTKF-NRPQMVVLLPRLA----DD---------THPATLYMLEVSYTSQH-------HF 406

  Fly   297 NPKDFVNFNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQ------------E 349
              .||....:...|.:    ....:|:...|.:|..|       |.:....|            :
  Fly   407 --WDFPALRTTKTECS----EEQLNAIDQLIDSTDLE-------CTLRDTQQPRPWAQNDLLPFD 458

  Fly   350 ATINIWLKS-----EHKL--SDDSKDKFLVMAMVAPGGECGGADVTELWR------SKSPTSADV 401
            |..:|:.::     |.|:  .:|.:||.|        .:...|||  .||      .||..:|.:
  Fly   459 ALPSIFEQNVMDILERKVIYDNDKEDKML--------KDKNFADV--FWRVPDPLEEKSKRAAAI 513

  Fly   402 EQHRLVCRFDE-------NKSKAQLDCASKSSKASVDCSKKS-GAG-VDPATAMERQLAFTQNLQ 457
            .:.....|:..       .|.:|:...|.||..|..:....| |.| :||.:...|.||....:.
  Fly   514 VKKLFPLRYSRAWQEKLLAKEQAENGVAVKSEPAEKEIPLPSDGVGLIDPISDFRRVLASVHTIS 578

  Fly   458 YVT 460
            ..|
  Fly   579 NAT 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 24/131 (18%)
Motile_Sperm 293..396 CDD:279029 24/127 (19%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 61/334 (18%)
Ku_PK_bind 562..663 CDD:285938 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.