DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CG3191

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001245486.2 Gene:CG3191 / 31209 FlyBaseID:FBgn0023525 Length:309 Species:Drosophila melanogaster


Alignment Length:241 Identity:43/241 - (17%)
Similarity:88/241 - (36%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCILRQSTG 77
            :||.|......||.             |.|:.||:::|  :..|.|.:.:|:..           
  Fly    71 VEETRKLIEVNYAL-------------RNRHPHLFIKR--DPLDADSKRTFDYA----------- 109

  Fly    78 ANDI--------DESELN----QEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSKNLDELIRIVV 130
              ||        |:.:::    :|:  |.|...|..|.     ..|.:....:....|:|.:..|
  Fly   110 --DILPLPGLTPDKCKVSLYCFREF--EASKMHHTEDT-----RAFFMVSDCRFVTPDDLAKPDV 165

  Fly   131 YWVERTQREQHLTQLTIFFDMSGTS---LASMDLEFVKRIVETFKQFYPNSLNYILVYELGWVLN 192
            ......|          .|||.||:   ::.:.:..::..::..:..:|..|..|.:......|:
  Fly   166 LSEGEVQ----------IFDMKGTTMRHISRLTISTLRAYIKFLQLAFPVRLRAIHMINCPTYLD 220

  Fly   193 AAFKVIKAVLPPKAVEILKMI-----SKKDINQYINKDNCLAIWGG 233
               :::..|.|..:.|:.|:|     |...:.:::.::.....:||
  Fly   221 ---RIVSVVKPFISDEVFKLIRFHTQSINTLYEFVPREMLPEEYGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 25/148 (17%)
Motile_Sperm 293..396 CDD:279029
CG3191NP_001245486.2 SEC14 114..263 CDD:238099 26/168 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.