DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Ttpal

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:212 Identity:48/212 - (22%)
Similarity:80/212 - (37%) Gaps:38/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSL--------- 66
            :.::.|||...::|       |:..|.:     |..:|.|||.....|.:.:...|         
  Rat    57 RDVQALRDMVRKEY-------PYLSTSL-----DDAFLLRFLRARKFDYDRALQLLVNYHGCRRS 109

  Fly    67 WETCI--LRQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSK-NLDELIRI 128
            |....  ||.| ...|:    ||..:|   :|..| ||..|..:|..|......|. .:.|.||.
  Rat   110 WPEVFSNLRPS-ALKDV----LNSGFL---TVLPH-TDPRGCHVLCIRPDRWIPSNYPITENIRA 165

  Fly   129 VVYWVER--TQREQHLTQLTIFFDMSGTSL--ASMDLEFV-KRIVETFKQFYPNSLNYILVYELG 188
            :...:|:  ...|..:..:.|..|..|.||  ||....|: ::::...:..:|..:..:.:....
  Rat   166 IYLTLEKLIQSEETQVNGVVILADYKGVSLSKASHFGPFIARKVIGILQDGFPIRIKAVHIVNEP 230

  Fly   189 WVLNAAFKVIKAVLPPK 205
            .:....|.:||..|..|
  Rat   231 RIFKGIFAIIKPFLKEK 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 27/118 (23%)
Motile_Sperm 293..396 CDD:279029
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 13/57 (23%)
SEC14 122..278 CDD:238099 31/134 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.