DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:260 Identity:55/260 - (21%)
Similarity:105/260 - (40%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIR-NDHLWLQRFLEMYDLDMETSFNSLWET 69
            :||..:.:.||::....:.||....|   ....:|:: .|..:|.||:.....|:..::..|...
  Rat    56 EETRDEAVRELQELVQAQAASGEELA---VAVAERVQARDSAFLLRFIRARKFDVGRAYELLKGY 117

  Fly    70 CILR-QSTGANDIDESELNQEYLK---EGSV--FVHNTDVDGKPLLVFRVK-MHSKSKNLDELIR 127
            ...| |.....|    .|:.|.|:   |...  .:.:.|..|:.:::|.:: .|.:....||:::
  Rat   118 VNFRLQYPELFD----SLSMEALRCTIEAGYPGVLSSRDKYGRVVMLFNIENWHCEEVTFDEILQ 178

  Fly   128 IVVYWVERTQREQHLTQLTIF--------FDM-SGTSLASMDLEFVKRIVETFKQFYPNSLNYIL 183
            ...:.:|:. .|...||:..|        |.| ....|...||   |::|:..:..:|.....|.
  Rat   179 AYCFILEKL-LENEETQINGFCIVENFKGFTMQQAAGLRPSDL---KKMVDMLQDSFPARFKAIH 239

  Fly   184 VYELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINK--DNCL-AIWGGE-DNYEFSFVPE 244
            .....|.....:.|:|..|..|.::.: .:...|::.:..:  :|.| |.:||. ..|:...|.|
  Rat   240 FIHQPWYFTTTYNVVKPFLKNKLLQRV-FVHGDDLDGFFQEIDENILPADFGGTLPKYDGKVVAE 303

  Fly   245  244
              Rat   304  303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 30/154 (19%)
Motile_Sperm 293..396 CDD:279029
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024 12/59 (20%)
CRAL_TRIO 143..292 CDD:279044 30/153 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.