DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Mospd3

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001020800.1 Gene:Mospd3 / 288557 RGDID:1304973 Length:235 Species:Rattus norvegicus


Alignment Length:200 Identity:43/200 - (21%)
Similarity:78/200 - (39%) Gaps:42/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 PSEG---MLHINPKDFVNFNS---KNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPN 347
            ||.|   .:.:.|.|.| |.:   ......:|:.:...:|:.:::..|:|.|:.|....|.::| 
  Rat    26 PSSGPVVPVLVFPPDLV-FRADQRSGPRQLLTLYNPTGTALRFRVLCTAPAKYTVFDAEGYVKP- 88

  Fly   348 QEATINIWLKSEHKLSD--DSKDKFLVMAMV--APGGECGGADVTELWRSKSPTSADVEQHRLVC 408
             ::.|:|.::....:..  |.:|:|.:....  |.|...|..|||.:.|:.: ...:::.|    
  Rat    89 -QSCIDIVIRHVAPIPSHYDVQDRFRIELSEEGAEGRVVGRKDVTSVLRAPA-YPLELQGH---- 147

  Fly   409 RFDENKSKAQLDCASKSSKASVDCSKKSGAGVDPATAMERQLAFTQNLQYVTLALLFLLFAGF-- 471
                             |:.:.:....|..|..||    |.|......|..|.:.|..|.||.  
  Rat   148 -----------------SEPTPNPGPPSWTGPTPA----RHLQENAPQQLATSSFLLFLLAGIIS 191

  Fly   472 -GFLM 475
             .||:
  Rat   192 VAFLL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 24/109 (22%)
Mospd3NP_001020800.1 Motile_Sperm 41..133 CDD:395510 20/94 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.