DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and Ttpa

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:206 Identity:43/206 - (20%)
Similarity:73/206 - (35%) Gaps:75/206 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSL-----WET-CI 71
            :.|||   .|......|..|...||        .:|.|||...|.|::.::..:     |.. | 
  Rat    28 LAELR---RRAQEEGVPETPQPLTD--------AFLLRFLRARDFDLDLAWRLMKNYYKWRAEC- 80

  Fly    72 LRQSTGANDIDESELNQE--------YLKEG-SVFVHNTDVDGKPLLVFRVKMHSKSKNLDELIR 127
                        .||:.:        .||.| ...:.:.|..|..:|::|:.             
  Rat    81 ------------PELSADLHPRSILGLLKAGYHGVLRSRDPTGSRVLIYRIS------------- 120

  Fly   128 IVVYWVERTQREQHLTQLTIF--FDMSGTSLASMDLEFVKRIVETFKQFYPNSLNYILVYELGWV 190
               ||..:           :|  :|:...||.:.:|  :.:.|||.:    |.:..|...| ||.
  Rat   121 ---YWDPK-----------VFTAYDVFRVSLITSEL--IVQEVETQR----NGVKAIFDLE-GWQ 164

  Fly   191 LNAAFKVIKAV 201
            ::.||::..:|
  Rat   165 ISHAFQITPSV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 23/111 (21%)
Motile_Sperm 293..396 CDD:279029
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
CRAL_TRIO_N 25..73 CDD:215024 14/55 (25%)
CRAL_TRIO 99..248 CDD:395525 23/111 (21%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.