Sequence 1: | NP_001261457.1 | Gene: | CG33523 / 38668 | FlyBaseID: | FBgn0053523 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_037180.1 | Gene: | Ttpa / 25571 | RGDID: | 3915 | Length: | 278 | Species: | Rattus norvegicus |
Alignment Length: | 206 | Identity: | 43/206 - (20%) |
---|---|---|---|
Similarity: | 73/206 - (35%) | Gaps: | 75/206 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 IEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSL-----WET-CI 71
Fly 72 LRQSTGANDIDESELNQE--------YLKEG-SVFVHNTDVDGKPLLVFRVKMHSKSKNLDELIR 127
Fly 128 IVVYWVERTQREQHLTQLTIF--FDMSGTSLASMDLEFVKRIVETFKQFYPNSLNYILVYELGWV 190
Fly 191 LNAAFKVIKAV 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33523 | NP_001261457.1 | CRAL_TRIO | 94..234 | CDD:279044 | 23/111 (21%) |
Motile_Sperm | 293..396 | CDD:279029 | |||
Ttpa | NP_037180.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..22 | ||
CRAL_TRIO_N | 25..73 | CDD:215024 | 14/55 (25%) | ||
CRAL_TRIO | 99..248 | CDD:395525 | 23/111 (21%) | ||
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 | 190..192 | ||||
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 | 208..211 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |