DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CG30339

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:290 Identity:60/290 - (20%)
Similarity:108/290 - (37%) Gaps:36/290 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KVKETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWE 68
            :|:|..|..::.|||     :.:..|..        |.|.|..:|..||......:|.:.:.|..
  Fly    21 EVEERVPADLKALRD-----WLAKQPHL--------RARQDDQFLVGFLRGCKFSLEKTKSKLDH 72

  Fly    69 ----TCILRQSTGANDIDESELNQEYLKEGSVFVH---NTDVDGKPL-LVFRVKMHSKSKNLDEL 125
                ..::.:..|...:||..|   .|.....:|.   ....||..| |....|...|...|.:|
  Fly    73 FYTIKTLMPELFGKRLVDERNL---ILCRSGTYVRLPKPWGTDGPRLQLTNYEKFDPKEFKLLDL 134

  Fly   126 IRIVVYWVERTQREQHLTQLTIFFD------MSGTSLASMDLEFVKRIVETFKQFYPNSLNYILV 184
            .|......|::.||...:.::.:.:      ||.:.||.:|...:||:....::..|..|..:.:
  Fly   135 FRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKRMGIFAEKAQPTRLKGVHL 199

  Fly   185 YELGWVLNAAFKVIKAVLPPKAVEILKMISK-KDINQYINKDNCLAIWGGEDNYEFSFVPEAKKV 248
            ........|...:.|:::|.|..:...:... :.:|:.|.::.....:||.:........||:|.
  Fly   200 INCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNNGRIADIQAEAEKK 264

  Fly   249 ISKPVAANAGD-----DDQFADKKVTFVDS 273
            :....:..|.|     |:|....|....||
  Fly   265 LLSYESYFAEDSQYGVDEQLRPGKRVNADS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 29/150 (19%)
Motile_Sperm 293..396 CDD:279029
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/54 (20%)
CRAL_TRIO 109..250 CDD:279044 28/140 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.