DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and ZC196.2

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_505251.2 Gene:ZC196.2 / 191101 WormBaseID:WBGene00022546 Length:345 Species:Caenorhabditis elegans


Alignment Length:227 Identity:54/227 - (23%)
Similarity:88/227 - (38%) Gaps:62/227 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 MLHINPKDFVNFN-SKNAEAT--MTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINI 354
            :|.:.|.|...|| |.|...|  :|:|:|:...|.:|::|:.|..:..||...:::|.:...:::
 Worm     7 LLEVTPCDNFVFNKSTNLTDTAYVTLKNISEKPVCFKVKTSVPNMYVSRPNPDLLKPGEARQLSV 71

  Fly   355 WLKSEHKLSDDSKDKFLVMAMVAPGGECGGADVTEL---WRS---------KSP------TSADV 401
            ..:|..|:|.::|...|.:...    |....|:.:|   |.|         |||      :|.|.
 Worm    72 KFRSSDKVSLNAKSYKLKIESC----EFESEDIDDLKSFWSSIPNEKILVHKSPIILGTGSSPDF 132

  Fly   402 EQHRLVCRFDENKSKAQLDCASKSSKASVDCSKKS--GAGVDPATAMERQ--------LAFTQNL 456
            ...::               ||:||:.|......|  |.....:||.:.|        |.:|:.|
 Worm   133 RNDQI---------------ASESSRQSSPIQNVSDDGKSSHHSTAKQLQENNENSKSLKYTKQL 182

  Fly   457 QYVTLALLFLLFAGFGFLMYQQLGQHAATCPK 488
            ..|.|.            ..||..|...||.|
 Worm   183 VEVPLG------------ENQQADQTGTTCDK 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 29/117 (25%)
ZC196.2NP_505251.2 Motile_Sperm 7..112 CDD:279029 28/108 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3654
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.