DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and C15H11.1

DIOPT Version :10

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_506565.2 Gene:C15H11.1 / 182646 WormBaseID:WBGene00007613 Length:122 Species:Caenorhabditis elegans


Alignment Length:102 Identity:26/102 - (25%)
Similarity:43/102 - (42%) Gaps:4/102 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 TPSEGMLHINPKDFVNFNSKNAEATMTIKSIATSA---VTYKIQTTSPEKFRVRPRCGIIQPNQE 349
            |..:..:...|.|.:.|.|...|...||..|...:   ..:|::.|..:.||::|..||:..||.
 Worm     2 TEKKQFIATEPSDKIQFLSDPREEQKTILKITNQSEMKQAFKVKCTRNDLFRIKPSTGILDYNQT 66

  Fly   350 ATINIWLKSEHKLSDDSKDKFLVMAMVAPGG-ECGGA 385
            .|:.:..:...:.....:..|.|..:.||.. .|.||
 Worm    67 LTVILVYRGGQETVPIDRQHFGVYHIPAPENCTCEGA 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..233 CDD:459890
Motile_Sperm 293..396 CDD:459882 25/97 (26%)
C15H11.1NP_506565.2 Motile_Sperm 8..99 CDD:459882 22/90 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.