DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and R03A10.5

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:344 Identity:69/344 - (20%)
Similarity:136/344 - (39%) Gaps:81/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGVKVKETTP---QQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQ--RFLEMYDLDME 60
            |.||..:..|   ::|::||:      ......:.::.||.:.:|    |||  ..|.:.::..:
 Worm     1 MTVKENDIQPYDLKKIQQLRE------LVKDDISEYYNTDFNILR----WLQGHNTLPIEEIARK 55

  Fly    61 TSFNSLWETCILRQSTGANDIDESELN---QEYLKEG---------SVFVH-----NTDVDG--K 106
            ..|:     ..||.:...:::.:.|.|   .::.|.|         :|.|:     .||..|  :
 Worm    56 MKFH-----LNLRAAWNLDELHKKERNHPIHKHWKYGITGPSGHMDNVIVNIEQCGKTDYTGMME 115

  Fly   107 PLLVFRVKMHSKSKNLDELIRIVVYWVERTQRE------QHLTQLTI---FFDMSGTSLASMDLE 162
            ...:..| |.::..:|::::..|:....:|.::      ..:|.|..   .:|:...|:.|:...
 Worm   116 TYSILEV-MRARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTGSMKSLADF 179

  Fly   163 FVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMIS----KKDINQYIN 223
            .....||..|.|.|     :.|....   .|.:.|::.:||.|..|.:::|.    :.|:.||..
 Worm   180 MADHYVEMIKYFVP-----VCVPSFA---TALYVVVRPLLPEKTREKVRLIGETNWRDDVLQYAI 236

  Fly   224 KDNCLAIWGGEDNYEFSFVPEAKKVISKPVAANAGDDDQFADKKVTFVDSAPMVLKETNINKMHT 288
            ..:..:||..|::....|:   :..|..|.      |..::.|..:.|.:|..|    |:     
 Worm   237 HSSLPSIWNNENHTFGGFI---ELPIGYPT------DGYYSAKNHSVVKNAQTV----NV----- 283

  Fly   289 PSEGMLHINPKDFVNFNSK 307
             ..|.:|:..| |:....|
 Worm   284 -PYGKIHVVTK-FIKAGRK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 34/168 (20%)
Motile_Sperm 293..396 CDD:279029 4/15 (27%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 37/180 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.