DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and C34D10.1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_001379696.1 Gene:C34D10.1 / 181060 WormBaseID:WBGene00016406 Length:205 Species:Caenorhabditis elegans


Alignment Length:146 Identity:28/146 - (19%)
Similarity:56/146 - (38%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 FVN-------FNSKNAEATMTIKSIATSAVTYKIQTTSPEKFRVRPRCGIIQPNQEATINIWLKS 358
            |||       .|.|:.....|:.:.....:||||..|:...:.|....|::|  .:...:|.::.
 Worm    12 FVNTTELQFRLNEKSQAKLFTLYNPFGHVITYKILCTATRNYTVNETTGVLQ--AKCCQDIVVRC 74

  Fly   359 EHKLSDDSKDKFLVMAMVAPGGECGGADVTELWRSKSPTSADVEQHRLVCRFDE--NKSKAQLDC 421
            ..:|...:.||..:                |:.:..|||::......|:....|  |..:.:.:.
 Worm    75 IQRLPVGNVDKLKI----------------EISKKGSPTASGSCVLTLLTVSSEHTNPDEPRFEK 123

  Fly   422 ASKSSKASVDCSKKSG 437
            ..:|::.|...:.:.|
 Worm   124 VQQSNRMSSSTTSERG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044
Motile_Sperm 293..396 CDD:279029 19/101 (19%)
C34D10.1NP_001379696.1 Motile_Sperm 11..>92 CDD:421531 19/97 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5066
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.