DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and cgr-1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:272 Identity:55/272 - (20%)
Similarity:99/272 - (36%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKETTPQQ---IEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLD-------- 58
            :.|.|..|   |.|||.:.....|:.|.    :.||...:|    ||..:  .|.:|        
 Worm    10 LNELTAHQKDKIAELRSKTKDILATYPE----YDTDFSLLR----WLMGW--DYKIDVIVPKMRY 64

  Fly    59 -METSFNSLWETCILRQSTGANDIDESELNQ----EYL--------KEGSVFVHNTDVDGKPLLV 110
             :||..|.....   :|:|..:.|:....|.    ||.        |.|.|..........|   
 Worm    65 AVETLVNLGMNN---KQTTSVDQINRDIKNMSAVAEYFPGGIMGKSKRGDVVYMQAMAKAHP--- 123

  Fly   111 FRVKMHSKSKNLDELIRIVVYWVERT-----QREQHLTQ---LTIFFDMSGTS---LASMDLEFV 164
               |...|:....:|.::.:...|.:     |.||...:   :.|..|:.|.|   |.:..|:..
 Worm   124 ---KTLVKAGPTSQLFQLCISETEMSFKIIRQTEQETERKMGVIIIMDLDGFSMDLLYTPTLKVY 185

  Fly   165 KRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKAVLPPKAVEILKMIS---KKDINQYINKDN 226
            ..::...:..:|:....|.:.....:::|.:.::..||..:..|.::.:.   |..:.:.|.::|
 Worm   186 MSLLTMLQNIFPDFARRIYIINCPAMMSAVYAMVSPVLSSQTREKVRFLDKDWKNHLIEEIGEEN 250

  Fly   227 CLAIWGGEDNYE 238
            ....|||...:|
 Worm   251 IFMHWGGVKKHE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 27/153 (18%)
Motile_Sperm 293..396 CDD:279029
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 30/171 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.