Sequence 1: | NP_001261457.1 | Gene: | CG33523 / 38668 | FlyBaseID: | FBgn0053523 | Length: | 654 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495146.1 | Gene: | K05F1.9 / 173982 | WormBaseID: | WBGene00019410 | Length: | 218 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 41/195 - (21%) |
---|---|---|---|
Similarity: | 76/195 - (38%) | Gaps: | 38/195 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 264 ADKKVTFVDSAPMVLKETNINKMHTPSEGMLHINPK--DFVNFNSKNAEATMTIKSIATSAVTYK 326
Fly 327 IQTTSPEKFRVRPRCGIIQPNQEATINIWLKSEHKLSDDSKDKFLVMAMVAPGGECGGADVTELW 391
Fly 392 RSKS------------------PTSADVEQHRLVCRFDENKSKAQLDCASKSSKASVDCSKKSGA 438
Fly 439 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33523 | NP_001261457.1 | CRAL_TRIO | 94..234 | CDD:279044 | |
Motile_Sperm | 293..396 | CDD:279029 | 23/122 (19%) | ||
K05F1.9 | NP_495146.1 | Motile_Sperm | 18..124 | CDD:279029 | 23/111 (21%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5066 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |