DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33523 and CLVS1

DIOPT Version :9

Sequence 1:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster
Sequence 2:NP_775790.1 Gene:CLVS1 / 157807 HGNCID:23139 Length:354 Species:Homo sapiens


Alignment Length:239 Identity:44/239 - (18%)
Similarity:80/239 - (33%) Gaps:52/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETCILRQS 75
            |.|:::||....:            .||..:|.|..::.|||.........:|..|.:....|| 
Human    51 QDIQQVRDMIITR------------PDIGFLRTDDAFILRFLRARKFHQADAFRLLAQYFQYRQ- 102

  Fly    76 TGANDIDESELNQEYLKE---GSVFVHNTDVDGKP-------------LLVFRVKMHSKSKNLDE 124
                      ||.:..|.   ....:....:||.|             ||:|.........:..:
Human   103 ----------LNLDMFKNFKADDPGIKRALIDGFPGVLENRDHYGRKILLLFAANWDQSRNSFTD 157

  Fly   125 LIRIVVYWVE--RTQREQHLTQLTIFFDMSGTSL---ASMDLEFVKRIVETFKQFYPNSLNYILV 184
            ::|.::..:|  ....|..:....:..|.|..|.   :.:....:|..:|..:..:|.....:..
Human   158 ILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLTPSILKLAIEGLQDSFPARFGGVHF 222

  Fly   185 YELGWVLNAAFKVIKAVLPPKAVEILKMISKKDINQYINKDNCL 228
            ....|.::|.:.:||..|..|        ::|.|..:.|..|.|
Human   223 VNQPWYIHALYTLIKPFLKDK--------TRKRIFLHGNNLNSL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 26/153 (17%)
Motile_Sperm 293..396 CDD:279029
CLVS1NP_775790.1 CRAL_TRIO_N 51..97 CDD:215024 13/57 (23%)
CRAL_TRIO 125..274 CDD:306996 25/142 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.