DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SEC14L5

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_055507.1 Gene:SEC14L5 / 9717 HGNCID:29032 Length:696 Species:Homo sapiens


Alignment Length:179 Identity:46/179 - (25%)
Similarity:78/179 - (43%) Gaps:24/179 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEA----NLNQEFLNDGSIYVHNKDRDG 104
            |..|.:.|:.:||.::|....|..:|:|||...|..:.:.    .|.:||...|   .|.:|.||
Human   264 DEHILRFLRAHDFHLDKAREMLRQSLSWRKQHQVDLLLQTWQPPALLEEFYAGG---WHYQDIDG 325

  Fly   105 KPLLILTI-----KKHSKSRNQEDLLRILVFWIERLQRDSN---------LDKITIFMDMTGAGL 155
            :||.||.:     |...|:..:|.|||.::...|..|:...         :...|..:|:.|..:
Human   326 RPLYILRLGQMDTKGLMKAVGEEALLRHVLSVNEEGQKRCEGSTRQLGRPISSWTCLLDLEGLNM 390

  Fly   156 SNLDMGFIKSI---IGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFL 201
            .:|....:|::   |.|.|..||.....:|:...|.:....:.|:..|:
Human   391 RHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLISPFI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 31/127 (24%)
SEC14L5NP_055507.1 PRELI 17..173 CDD:309720
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 178..214
CRAL_TRIO_N 243..288 CDD:215024 7/23 (30%)
SEC14 306..479 CDD:214706 34/137 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.