DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SEC14

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_013796.1 Gene:SEC14 / 855103 SGDID:S000004684 Length:304 Species:Saccharomyces cerevisiae


Alignment Length:264 Identity:64/264 - (24%)
Similarity:112/264 - (42%) Gaps:42/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PSDQDP-TPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRL 65
            |.|..| ||..:...:...|..|.|......|    ::|:.||.|  .:.|:...|||: ....:
Yeast    18 PPDALPGTPGNLDSAQEKALAELRKLLEDAGF----IERLDDSTL--LRFLRARKFDVQ-LAKEM 75

  Fly    66 WDNL-AWRKSFGV--------YDITEANLNQEFLNDGSIYVHNKDRDGKPLLI-----LTIKKHS 116
            ::|. .|||.:|.        ||  |..|..:|...   |.|..|:||:|:..     :.:.:.:
Yeast    76 FENCEKWRKDYGTDTILQDFHYD--EKPLIAKFYPQ---YYHKTDKDGRPVYFEELGAVNLHEMN 135

  Fly   117 KSRNQEDLLRILVFWIE-----RLQRDSN-----LDKITIFMDMTGAGLSNL--DMGFIKSIIGV 169
            |..::|.:|:.||:..|     ||...|.     ::.....||:.|..:|:.  .|.:::....:
Yeast   136 KVTSEERMLKNLVWEYESVVQYRLPACSRAAGHLVETSCTIMDLKGISISSAYSVMSYVREASYI 200

  Fly   170 FETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK---ILKVTTKKDIDQYVDKDNCLKIWG 231
            .:..||.......:.:.||....||:|.|.||.|..:.   ||..:.:|::.:.:..:|....:|
Yeast   201 SQNYYPERMGKFYIINAPFGFSTAFRLFKPFLDPVTVSKIFILGSSYQKELLKQIPAENLPVKFG 265

  Fly   232 GNDD 235
            |..:
Yeast   266 GKSE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 36/160 (23%)
SEC14NP_013796.1 CRAL_TRIO_N 34..79 CDD:215024 12/51 (24%)
SEC14 99..269 CDD:214706 40/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.