DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and YKL091C

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_012832.1 Gene:YKL091C / 853771 SGDID:S000001574 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:65/266 - (24%)
Similarity:112/266 - (42%) Gaps:52/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKS 74
            |.:.|.::.:|::..||            |:.||.|  .:.|:...||:...:....:...||:.
Yeast    31 EALLQFRSILLEKNYKE------------RLDDSTL--LRFLRARKFDINASVEMFVETERWREE 81

  Fly    75 FGVYDITEANLNQEFLNDGS---------IYVHNKDRDGKPLLI-----LTIKKHSKSRNQEDLL 125
            :|...|.|...|.:...|..         .|.|:.|:||:||..     :.:||..|...::.:|
Yeast    82 YGANTIIEDYENNKEAEDKERIKLAKMYPQYYHHVDKDGRPLYFEELGGINLKKMYKITTEKQML 146

  Fly   126 RILV-----FWIERLQRDSN-----LDKITIFMDMTGAGLSNL--DMGFIKSIIGVFETKYP-YV 177
            |.||     |...|:...|.     ::.....:|:.|..|||.  .:.:||.:..:.:..|| .:
Yeast   147 RNLVKEYELFATYRVPACSRRAGYLIETSCTVLDLKGISLSNAYHVLSYIKDVADISQNYYPERM 211

  Fly   178 PNYILVHDLPFLLDAAFKLVKTFLPPEALK---ILKVTTKKDIDQYVDKDNCLKIWGG------- 232
            ..:.::|. ||.....||:||.||.|..:.   ||..:.||::.:.:..:|....:||       
Yeast   212 GKFYIIHS-PFGFSTMFKMVKPFLDPVTVSKIFILGSSYKKELLKQIPIENLPVKYGGTSVLHNP 275

  Fly   233 NDDYVY 238
            ||.:.|
Yeast   276 NDKFYY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 44/177 (25%)
YKL091CNP_012832.1 CRAL_TRIO_N 30..75 CDD:215024 12/57 (21%)
SEC14 101..271 CDD:214706 43/170 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.