DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SFH5

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:49/206 - (23%)
Similarity:86/206 - (41%) Gaps:26/206 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANL-NQEFLNDGSI-YVHNKDRDGKP----L 107
            ||.:.|.|:....:..|.|.|.||:.|.........: |.|..|.|.: :..|.|.:.|.    |
Yeast    63 KLCKAYQFEYSTIVQNLIDILNWRREFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNL 127

  Fly   108 LILTIKKHSKSRNQEDLLRILVFWIER-------LQRDSNLDKITIFMDMTGAGLSNLDMGF--- 162
            ....:||....:|.:..:|..:..:|:       ...|:|.  :|...|..|..:..:|...   
Yeast   128 YGQLVKKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDNNY--MTQVHDYKGVSVWRMDSDIKNC 190

  Fly   163 IKSIIGVFETKYP---YVPNYILVHDLPFLLDAAFKLVKTFLPPEA-LKILKVTTKKDIDQYVDK 223
            .|::||:|:..||   |...::   ::|.:....:.|:|.|:.... .|.:.:|....:.||: |
Yeast   191 SKTVIGIFQKYYPELLYAKYFV---NVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYL-K 251

  Fly   224 DNCLKIWGGND 234
            |...:.:||.|
Yeast   252 DCPYEGYGGKD 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/159 (21%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 39/168 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.