DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT1G75370

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001154472.1 Gene:AT1G75370 / 843873 AraportID:AT1G75370 Length:668 Species:Arabidopsis thaliana


Alignment Length:241 Identity:54/241 - (22%)
Similarity:95/241 - (39%) Gaps:58/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KLLQVYDFDVEKCITRL-WDN-LAWRKSFGVYDITEANLNQEFLNDGSIY---VHNKDRDGKPLL 108
            :.|:...||:.|  |:| |.| :.|||.||...|.|....:||......|   .|..|::|:|:.
plant   116 RFLKARKFDIGK--TKLMWSNMIKWRKDFGTDTIFEDFEFEEFDEVLKYYPHGYHGVDKEGRPVY 178

  Fly   109 I--LTIKKHSKSRNQEDLLRILVFWIERLQRDSN-------------LDKITIFMDMTGAGLSNL 158
            |  |.:...:|......:.|.:.:.:...::..|             :|..|..:|:.|.|..|.
plant   179 IERLGLVDPAKLMQVTTVERFIRYHVREFEKTVNIKLPACCIAAKRHIDSSTTILDVQGVGFKNF 243

  Fly   159 D---MGFIKSIIGVFETKYPYVPNYILVHDLPFLLD--AAFKL----VKTFLPPEAL-------- 206
            .   ...|..:..:....||..     :|.: |:::  :.|||    ||.||.|:.:        
plant   244 SKPARDLIIQLQKIDNDNYPET-----LHRM-FIINGGSGFKLVWATVKQFLDPKTVTKIHVIGN 302

  Fly   207 ----KILKVTTKKDIDQYV-------DKDNCLKIWGG--NDDYVYK 239
                |:|::.....:..::       |:..|::...|  ||..:.|
plant   303 KYQNKLLEIIDASQLPDFLGGTCTCADRGGCMRSDKGPWNDPEILK 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/188 (18%)
AT1G75370NP_001154472.1 CRAL_TRIO_N 89..135 CDD:215024 7/20 (35%)
SEC14 159..324 CDD:238099 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.