DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT1G55840

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_175980.1 Gene:AT1G55840 / 842034 AraportID:AT1G55840 Length:325 Species:Arabidopsis thaliana


Alignment Length:214 Identity:42/214 - (19%)
Similarity:83/214 - (38%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITKLLQVYDFDVEKCITRLWDNLAWRKSFGV-----YDITEANLNQEFLNDGSIYVHNKDRDGKP 106
            :.:.|:..|.:|:|....|.:.|.||....:     ..|...:|.:...:...:.|....::|.|
plant    39 LLRFLKARDGNVQKAHKMLLECLEWRTQNEIDKILTKPIVPVDLYRGIRDTQLVGVSGYSKEGLP 103

  Fly   107 LLILTIKKHSKSRNQEDLLRILVFWIERLQRDSNLDKITI----------------FMDMTGAGL 155
            ::.:.:     ..:..|...:..:....:|.:...|::.:                .:||:|..|
plant   104 VIAIGV-----GLSTYDKASVHYYVQSHIQMNEYRDRVVLPSASKKQGRPICTCLKILDMSGLKL 163

  Fly   156 SNL-DMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDID- 218
            |.| .:..:.:|..:.:..||.......|.::|::..|.:|.:|        .:|:..|||.|. 
plant   164 SALSQIKLMTAITTIDDLNYPEKTETYYVVNVPYIFSACWKTIK--------PLLQERTKKKIQV 220

  Fly   219 -QYVDKDNCLKIWGGNDDY 236
             :...||..|||.    ||
plant   221 LKGCGKDELLKIM----DY 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/159 (19%)
AT1G55840NP_175980.1 CRAL_TRIO_N 8..59 CDD:397711 5/19 (26%)
SEC14 91..242 CDD:214706 32/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.