DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT1G55690

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001323358.1 Gene:AT1G55690 / 842018 AraportID:AT1G55690 Length:625 Species:Arabidopsis thaliana


Alignment Length:280 Identity:59/280 - (21%)
Similarity:107/280 - (38%) Gaps:72/280 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN-LAWRKSF 75
            :.:.:..:|:|....|..:.:|.            :.:.|:..|.::|| .|:||:. |.|||.:
plant    79 VLEFRRKLLERDLLPPRHDEYHT------------LLRFLKARDLNIEK-TTQLWEEMLRWRKEY 130

  Fly    76 GV------YDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLRI------L 128
            |.      :|..|.....::...|   .|..|::|:|:.|..:.|...|:    |:||      |
plant   131 GTDTILEDFDFEELEEVLQYYPQG---YHGVDKEGRPVYIERLGKAHPSK----LMRITTIDRYL 188

  Fly   129 VFWIERLQR-------------DSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPN- 179
            .:.::..:|             ...:...|..:|:.|.|:.|........:..:.:....|.|. 
plant   189 KYHVQEFERALQEKFPACSIAAKRRICSTTTILDVQGLGIKNFTPTAANLVAAMSKIDNSYYPET 253

  Fly   180 ----YILVHDLPF---LLDAAFKLV--KTF-----LPPEAL-KILKVTTKKDIDQYV-------- 221
                ||:.....|   |..||.|.:  ||.     |.|::| |:.:|.....:.:::        
plant   254 LHRMYIVNAGTGFKKMLWPAAQKFLDAKTIAKIHVLEPKSLFKLHEVIDSSQLPEFLGGSCSCFG 318

  Fly   222 DKDNCLKIWGG--NDDYVYK 239
            |...||:...|  ||..:.|
plant   319 DGGGCLRSNKGPWNDPEIMK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/185 (21%)
AT1G55690NP_001323358.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.