DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT1G22180

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001322892.1 Gene:AT1G22180 / 838823 AraportID:AT1G22180 Length:314 Species:Arabidopsis thaliana


Alignment Length:247 Identity:58/247 - (23%)
Similarity:109/247 - (44%) Gaps:28/247 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPEQ----ISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            |||:    |::|:|.:....||   :..|         .||..||:.|...:..|:|....|.:.
plant    18 TPEEYLNKINEVRTLLGPLTEK---SSEF---------CSDAAITRYLAARNGHVKKATKMLKET 70

  Fly    69 LAWRKSFGVYDITEANLNQEFLNDGSIYVHN-KDRDGKPLLILTIKKHSKSRNQEDLLRILVFWI 132
            |.||..:...:|....:.:| ...|.||..| .|:.|:.:|::. .....:::.:..:||||:.:
plant    71 LKWRAQYKPEEIRWEEIARE-AETGKIYRANCTDKYGRTVLVMR-PSCQNTKSYKGQIRILVYCM 133

  Fly   133 ER--LQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFK 195
            |.  |....|.:::...:|..|..:|::.:...:....|.:..||......:|::.|.:.::.:|
plant   134 ENAILNLPDNQEQMVWLIDFHGFNMSHISLKVSRETAHVLQEHYPERLGLAIVYNPPKIFESFYK 198

  Fly   196 LVKTFLPPEALKILKVTTKKD------IDQYVDKDNCLKIWGG-NDDYVYKF 240
            :||.||.|:....:|.....|      ::...|.:.....:|| |.|..:.|
plant   199 MVKPFLEPKTSNKVKFVYSDDNLSNKLLEDLFDMEQLEVAFGGKNSDAGFNF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 33/150 (22%)
AT1G22180NP_001322892.1 CRAL_TRIO_N 25..70 CDD:215024 14/56 (25%)
SEC14 90..243 CDD:214706 34/154 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.