DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT1G14820

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_973831.1 Gene:AT1G14820 / 838047 AraportID:AT1G14820 Length:252 Species:Arabidopsis thaliana


Alignment Length:205 Identity:41/205 - (20%)
Similarity:79/205 - (38%) Gaps:27/205 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ITKLLQVYDFDVEKCITRLWDNLAWRKSF----GVYDITEANLNQEFLNDGSIYVHNKDRDGKPL 107
            :.:.|.....|..|......|...||.|.    |.  |.|:.:..| |....:.:....:.|.||
plant    31 LMRFLVARSMDPVKAAKMFVDWQKWRASMVPPTGF--IPESEVQDE-LEFRKVCLQGPTKSGHPL 92

  Fly   108 LILTIKKHSKSRNQEDLLRILVFWIERLQRDSNL------DKITIFMDMTGAGLSNLDMGFIKSI 166
            :::...||..|::..:..:.:|:.:::.....|.      :|:...:|:......|||   .:.:
plant    93 VLVITSKHFASKDPANFKKFVVYALDKTIASGNNGKEVGGEKLVAVIDLANITYKNLD---ARGL 154

  Fly   167 IGVFETKYPYVPN-----YILVHDLPFLLDAAFKLVKTFLPPEALKILKVTT----KKDIDQYVD 222
            |..|:....|.|.     |||  .:|......:|.|..||.....:.:.:.|    ::..::.:.
plant   155 ITGFQFLQSYYPERLAKCYIL--HMPGFFVTVWKFVCRFLEKATQEKIVIVTDGEEQRKFEEEIG 217

  Fly   223 KDNCLKIWGG 232
            .|...:.:||
plant   218 ADALPEEYGG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 29/156 (19%)
AT1G14820NP_973831.1 CRAL_TRIO_N 6..51 CDD:215024 3/19 (16%)
SEC14 80..227 CDD:238099 27/151 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.