DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT5G63060

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_201111.2 Gene:AT5G63060 / 836426 AraportID:AT5G63060 Length:263 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:93/209 - (44%) Gaps:31/209 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDQDPTPEQISQVKTSILQRLEKEPPAEPF--HPNDLKRITDSD--LWITKLLQVYDFDVEKCIT 63
            |:.....:.:.:||    :||.|:..:.|.  :..|     |.|  ||..|..:   |.|::.|.
plant    39 SESQHAHKLVLEVK----ERLAKDCTSLPLGKYGRD-----DEDMILWFLKDRR---FSVDEAIG 91

  Fly    64 RLWDNLAWRKSFGVYDITEANLNQEFLNDGSIYVHN-KDRDGKPLLILTIKKHSKSRNQEDLL-- 125
            :|...:.||..|.|.:::|.:: :...:.|..|||. .|..|:|::|:...||...     ||  
plant    92 KLTKAIKWRHEFKVDELSEDSI-KAATDTGKAYVHGFLDVKGRPVVIVAPAKHIPG-----LLDP 150

  Fly   126 ----RILVFWIERL--QRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVH 184
                ::.||.:|:.  :..:...||....|:.|.|..|.|:.|:..:..||...||...:.:|..
plant   151 IEDEKLCVFLLEKALSKLPAGQHKILGIFDLRGFGSQNADLKFLTFLFDVFYYYYPSRLDEVLFV 215

  Fly   185 DLPFLLDAAFKLVK 198
            |.||:....::..|
plant   216 DAPFIFQPIWQFTK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 32/116 (28%)
AT5G63060NP_201111.2 SEC14 118..261 CDD:214706 32/117 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.