DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT5G47730

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001330995.1 Gene:AT5G47730 / 834824 AraportID:AT5G47730 Length:341 Species:Arabidopsis thaliana


Alignment Length:270 Identity:57/270 - (21%)
Similarity:96/270 - (35%) Gaps:64/270 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLA 70
            |...|.:.||:..:.:..|:      .|...|:..      :.:.|:..|::|.|..|.|.:.|.
plant    10 DEFQELMDQVEEPLKKTYER------VHQGYLREN------LGRFLKARDWNVCKAHTMLVECLR 62

  Fly    71 WR-----KSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLIL--------------TIKKHS 116
            ||     .|.....|....|.::..:...|.:....::|.|:..:              .::.|.
plant    63 WRVDNEIDSILSKPIVPTELYRDVRDSQLIGMSGYTKEGLPVFAIGVGLSTFDKASVHYYVQSHI 127

  Fly   117 KSRNQEDLLRILVFWIERLQRDSNLDKITI---FMDMTGAGLSNLDMGFIKSIIG-VFETKYPYV 177
            :.....|  |:|:..|.:    .|...||.   .:||||..||.|....:.:||. :.:..||..
plant   128 QINEYRD--RVLLPSISK----KNGRPITTCVKVLDMTGLKLSALSQIKLVTIISTIDDLNYPEK 186

  Fly   178 PNYILVHDLPFLLDAAFKLVKTFLP---------------PEALKILKVTT--------KKDIDQ 219
            .|...|.:.|::..|.:|:||..|.               .|.|||:..|:        ......
plant   187 TNTYYVVNAPYIFSACWKVVKPLLQERTRKKVHVLSGCGRDELLKIMDFTSLPHFCRSGSSGSSH 251

  Fly   220 YVDKDNCLKI 229
            :....||..|
plant   252 HTQSANCFSI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/179 (21%)
AT5G47730NP_001330995.1 CRAL_TRIO_N 8..59 CDD:397711 13/60 (22%)
SEC14 91..242 CDD:214706 35/156 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.