DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT5G47510

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001331127.1 Gene:AT5G47510 / 834801 AraportID:AT5G47510 Length:377 Species:Arabidopsis thaliana


Alignment Length:262 Identity:59/262 - (22%)
Similarity:108/262 - (41%) Gaps:51/262 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            :|.|..|::.:...::| .|....|.:....|.|:|          .|::.|||:||......:.
plant    20 EQSPNNEEMVEAFRNLL-LLHGHLPDKHGDHNTLRR----------FLKMRDFDLEKSKEAFLNY 73

  Fly    69 LAWRKSFGVYDITEANLNQEFLNDGSIY---VHNKDRDGKPLLI--------------LTIKK-- 114
            :.||..:.|..|::....:|:......|   .|..|:.|:|:.|              .||::  
plant    74 MKWRVDYKVDLISQKFKFEEYGEVKKHYPHGFHKVDKTGRPIYIERLGMTDLNAFLKATTIERYV 138

  Fly   115 --HSKSRNQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYV 177
              |.|.:.:...||   :....:..|.::...|..:|::|.|:||    |.|....:|.......
plant   139 NYHIKEQEKTMSLR---YPACSIASDKHVSSTTTILDVSGVGMSN----FSKPARSLFMEIQKID 196

  Fly   178 PNYI--LVHDLPFLLDAA--FKL----VKTFLPPEAL---KILKVTTKKDIDQYVDKDNCLKIWG 231
            .||.  .:|.| |:::|:  |::    :||||....|   ::|......::.:.::..|.....|
plant   197 SNYYPETLHRL-FVVNASSGFRMLWLALKTFLDARTLAKVQVLGPNYLGELLEAIEPSNLPTFLG 260

  Fly   232 GN 233
            ||
plant   261 GN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 37/172 (22%)
AT5G47510NP_001331127.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.