powered by:
Protein Alignment CG32407 and AT5G47180
DIOPT Version :9
Sequence 1: | NP_001261456.1 |
Gene: | CG32407 / 38667 |
FlyBaseID: | FBgn0052407 |
Length: | 241 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199529.1 |
Gene: | AT5G47180 / 834764 |
AraportID: | AT5G47180 |
Length: | 220 |
Species: | Arabidopsis thaliana |
Alignment Length: | 37 |
Identity: | 11/37 - (29%) |
Similarity: | 17/37 - (45%) |
Gaps: | 7/37 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 201 LPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYV 237
:.|:.||.|....|: .|.| ||:....::||
plant 12 IQPDELKFLFELEKQ---SYCD----LKVANKTENYV 41
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.