DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT5G47180

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_199529.1 Gene:AT5G47180 / 834764 AraportID:AT5G47180 Length:220 Species:Arabidopsis thaliana


Alignment Length:37 Identity:11/37 - (29%)
Similarity:17/37 - (45%) Gaps:7/37 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYV 237
            :.|:.||.|....|:   .|.|    ||:....::||
plant    12 IQPDELKFLFELEKQ---SYCD----LKVANKTENYV 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 9/31 (29%)
AT5G47180NP_199529.1 Motile_Sperm 9..116 CDD:395510 11/37 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.