DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SEC14

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_195629.2 Gene:SEC14 / 830073 AraportID:AT4G39180 Length:554 Species:Arabidopsis thaliana


Alignment Length:250 Identity:55/250 - (22%)
Similarity:106/250 - (42%) Gaps:62/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSDLWITKLLQVYDFDVEKCITRLW-DNLAWRKSFGV------YDITEANLNQEFLNDGSIYVHN 99
            |....:.:.|:...||:||. .::| |.|.|||.:|.      :|..|.....::...|   .|.
plant    92 DDHHMMLRFLRARKFDLEKA-KQMWSDMLNWRKEYGADTIMEDFDFKEIEEVVKYYPQG---YHG 152

  Fly   100 KDRDGKPLLILTIKK--HSKSRNQEDLLRILVFWIERLQRDSN-------------LDKITIFMD 149
            .|::|:|:.|..:.:  .:|......:.|.:.:.::..::..|             :|:.|..:|
plant   153 VDKEGRPIYIERLGQVDATKLMKVTTIDRYVKYHVKEFEKTFNVKFPACSIAAKRHIDQSTTILD 217

  Fly   150 MTGAGLSNLDMG---FIKSIIGVFETKYPYVPNYILVHDLPFLLDA--AFKL----VKTFLPPEA 205
            :.|.||||.:..   .::||..:....||...|.:      |:::|  .|:|    ||:||.|:.
plant   218 VQGVGLSNFNKAAKDLLQSIQKIDNDNYPETLNRM------FIINAGCGFRLLWNTVKSFLDPKT 276

  Fly   206 ------------LKILKVTTKKDIDQYV-------DKDNCLKIWGG--NDDYVYK 239
                        .|:|::....::.:::       ||..|::...|  ||..::|
plant   277 TAKIHVLGNKYQTKLLEIIDANELPEFLGGKCTCADKGGCMRSDKGPWNDPEIFK 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 37/185 (20%)
SEC14NP_195629.2 CRAL_TRIO_N 72..115 CDD:215024 6/23 (26%)
SEC14 138..308 CDD:214706 34/178 (19%)
Prefoldin 491..>529 CDD:298833
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.