DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and COW1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001328041.1 Gene:COW1 / 829610 AraportID:AT4G34580 Length:554 Species:Arabidopsis thaliana


Alignment Length:245 Identity:53/245 - (21%)
Similarity:101/245 - (41%) Gaps:62/245 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KLLQVYDFDVEKCITRLW-DNLAWRKSFGV------YDITEANLNQEFLNDGSIYVHNKDRDGKP 106
            :.|:...||:||. .::| |.:.|||.||.      :|..|.:...:....|   .|..|::|:|
plant    91 RFLRARKFDIEKA-KQMWSDMIQWRKDFGADTIIEDFDFEEIDEVMKHYPQG---YHGVDKEGRP 151

  Fly   107 LLILTIKK--HSKSRNQEDLLRILVFWIERLQR-------------DSNLDKITIFMDMTGAGLS 156
            :.|..:.:  .:|......:.|.:.:.::..::             :.::|:.|..:|:.|.||.
plant   152 VYIERLGQIDANKLLQVTTMDRYVKYHVKEFEKTFKVKFPSCSVAANKHIDQSTTILDVQGVGLK 216

  Fly   157 NLDMG---FIKSIIGVFETKYPYVPNYILVHDLPFLLDA--AFKL----VKTFLPPEAL------ 206
            |....   .::.:..:....||...|.:      |:::|  .|:|    ||:||.|:..      
plant   217 NFSKSARELLQRLCKIDNENYPETLNRM------FIINAGSGFRLLWSTVKSFLDPKTTAKIHVL 275

  Fly   207 ------KILKVTTKKDIDQYV-------DKDNCLKIWGG--NDDYVYKFA 241
                  |:|:|....::.::.       ||..|::...|  ||..|.|.|
plant   276 GNKYHSKLLEVIDASELPEFFGGACTCEDKGGCMRSDKGPWNDPEVLKIA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/185 (18%)
COW1NP_001328041.1 CRAL_TRIO_N 64..107 CDD:215024 5/16 (31%)
SEC14 133..298 CDD:214706 30/173 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.